PDB entry 6tht

View 6tht on RCSB PDB site
Description: High resolution crystal structure of a Leaf-branch compost cutinase quintuple variant
Class: hydrolase
Keywords: hydrolase, serine esterase, cutinase
Deposited on 2019-11-21, released 2020-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lcc
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9BY57 (0-257)
      • engineered mutation (91)
      • engineered mutation (129)
      • engineered mutation (202)
      • engineered mutation (207)
      • engineered mutation (247)
    Domains in SCOPe 2.08: d6thta_
  • Heterogens: IMD, GOL, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6thtA (A:)
snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy
tadasslawlgrrlashgfvvlvintnsrfdgpdsrasqlsaalnylrtsspsavrarld
anrlavaghamggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv
sqhaipfyqnlpsttpkvyvelcnashiapnsnnaaisvytiswmklwvdndtryrqflc
nvndpalcdfrtnnrhcq