PDB entry 6ths

View 6ths on RCSB PDB site
Description: High resolution crystal structure of Leaf-branch cutinase S165A variant
Class: hydrolase
Keywords: hydrolase, serine esterase, cutinase
Deposited on 2019-11-21, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lcc
    Species: Uncultured bacterium [TaxId:77133]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G9BY57 (0-257)
      • engineered mutation (129)
    Domains in SCOPe 2.08: d6thsa_
  • Heterogens: DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6thsA (A:)
snpyqrgpnptrsaltadgpfsvatytvsrlsvsgfgggviyyptgtsltfggiamspgy
tadasslawlgrrlashgfvvlvintnsrfdypdsrasqlsaalnylrtsspsavrarld
anrlavaghamggggtlriaeqnpslkaavpltpwhtdktfntsvpvlivgaeadtvapv
sqhaipfyqnlpsttpkvyveldnashfapnsnnaaisvytiswmklwvdndtryrqflc
nvndpalsdfrtnnrhcq