PDB entry 6tgs

View 6tgs on RCSB PDB site
Description: atnbr1-pb1 domain
Deposited on 2019-11-17, released 2020-02-12
The last revision was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein NBR1 homolog
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: NBR1, At4g24690, F22K18.110
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SB64
      • engineered mutation (59-60)
      • engineered mutation (63)
  • Heterogens: GOL, PEG, SO4, CL, SIN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6tgsA (A:)
mestanalvvkvsyggvlrrfrvpvkangqldlemaglkekiaalfnlsadaelsltysa
adgavvalvddndlfdvtnqrlkflkinvnagvs

    Sequence, based on observed residues (ATOM records):
    >6tgsA (A:)
analvvkvsyggvlrrfrvpvkangqldlemaglkekiaalfnlsadaelsltysaadga
vvalvddndlfdvtnqrlkflkinvnag