PDB entry 6tgk

View 6tgk on RCSB PDB site
Description: domain swapped e6ap c-lobe dimer
Deposited on 2019-11-16, released 2020-02-26
The last revision was dated 2020-06-10, with a file datestamp of 2020-06-05.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: ubiquitin-protein ligase e3a
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE3A, E6AP, EPVE6AP, HPVE6A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6tgkC (C:)
ldfqaleetteydggytrdsvlirefweivhsftdeqkrlflqfttgtdrapvgglgklk
miiakngpdterlptshtcfnvlllpeysskeklkerllkaitya