PDB entry 6tg6

View 6tg6 on RCSB PDB site
Description: toprim domain of rnase m5
Deposited on 2019-11-15, released 2020-09-23
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribonuclease M5
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: rnmV_1, rnmV, AVP43_02013
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6tg6A (A:)
ggsmkikevivvegkddtaairravdadtietngaavgaevieriklakerrgviiftdp
dfpgekirrtiaeqvpgckhaflpreaakarsgkgigvehaspddirqalanvyee