SCOPe 2.08: Structural Classification of Proteins

PDB entry 6tdy

View 6tdy on RCSB PDB site
Description: cryo-em structure of euglena gracilis mitochondrial atp synthase, oscp/f1/c-ring in rotational state 1
Deposited on 2019-11-10, released 2019-11-27
The last revision was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: EM
Resolution: 3.04 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: ATP synthase subunit alpha
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-560)
Chain 'B':
Compound: ATP synthase subunit alpha
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-560)
Chain 'C':
Compound: ATP synthase subunit alpha
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-560)
Chain 'D':
Compound: ATP synthase subunit beta
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-493)
Chain 'E':
Compound: ATP synthase subunit beta
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-493)
Chain 'F':
Compound: ATP synthase subunit beta
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-493)
Chain 'G':
Compound: ATP synthase subunit gamma
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY
Chain 'H':
Compound: ATP synthase subunit delta
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-175)
Chain 'I':
Compound: ATP synthase subunit epsilon
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY
Chain 'J':
Compound: p18
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-191)
Chain 'K':
Compound: p18
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-191)
Chain 'L':
Compound: p18
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-191)
Chain 'M':
Compound: oligomycin sensitivity conferring protein (OSCP)
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY
Chain 'N':
Compound: inhibitor of F1 (IF1)
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY
Chain 'O':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'P':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'Q':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'R':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'S':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'T':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'U':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'V':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'W':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'X':
Compound: ATP synthase subunit c
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY (Start-103)
Chain 'c':
Compound: atptb4
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY
Chain 'h':
Compound: ATP synthase subunit d
Species: Euglena gracilis [TaxId:3039]
Database cross-references and differences (RAF-indexed):
- PDB 6TDY
Heterogens: ADP, ATP, MG, TRT

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

Chain 'A':
Sequence, based on SEQRES records:

>6tdyA (A:)
mhyaeaatpaksagsavakkhleakqkigfvhgidgtiatiapaaskvtvpyntvleiav
satnianalvfnlekdgsigvilldnisevrsgqdvyatgsllkipvgfhmlgkiinplg
keiptglftkaapllddtklglveemapnivsrqpvnynlltgykvidtlipvgrgqrel
ilgdrqtgktsialstilnqtkvnneilsknnvlsvyvsigqrcsnvarihrllteydam
kyctivaataadpaglqylapyagttlgeefrnsgrhillvyddlskqavsyrqislllr
rppgreaypgdvfylhsrllersammspqkgsgsltslpivetlsndvtayivtnvisit
dgqiyldaklftggqrpavniglsvsrvgssaqnkamkkvggalkmlmgeyrkmageqts
gsqnvspvmirgarclqlfnqkgpsyfmdaivalyavtngymddvklqyskfyeflllnk
dlpvlygqvnnkyfymynknlnyfiryfglnheilepelkkyieihtnlfldnyqsrmne
lksdedlvqlknllyackrtv