PDB entry 6tdm

View 6tdm on RCSB PDB site
Description: bam_5920cdd 5919ndd docking domains
Deposited on 2019-11-08, released 2020-08-12
The last revision was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-ketoacyl synthase,Beta-ketoacyl synthase
    Species: Burkholderia ambifaria AMMD [TaxId:339670]
    Gene: Bamb_5919
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0B308
      • expression tag (0-4)
      • linker (25-32)
    • Uniprot Q0B309
  • Chain 'B':
    Compound: Beta-ketoacyl synthase,Beta-ketoacyl synthase
    Species: Burkholderia ambifaria AMMD [TaxId:339670]
    Gene: Bamb_5919
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0B308 (5-24)
      • expression tag (0-4)
      • linker (25-32)
    • Uniprot Q0B309 (33-63)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6tdmA (A:)
    gpgsydaalpidelsallrqemgddgggsgggsmqdiqqllakslteikrlkaanqaleq
    arre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6tdmB (B:)
    gpgsydaalpidelsallrqemgddgggsgggsmqdiqqllakslteikrlkaanqaleq
    arre