PDB entry 6tci

View 6tci on RCSB PDB site
Description: the crystal structure of sleb n-terminal domain
Deposited on 2019-11-06, released 2020-11-18
The last revision was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spore cortex-lytic enzyme
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Gene: sleB, BC_2753
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6tciA (A:)
afsnqviqrgasgedvielqsrlkyngfytgkvdgvfgwgtywalrnfqekfglpvdgla
gaktkqmlvkatky

    Sequence, based on observed residues (ATOM records):
    >6tciA (A:)
afsnqviqrgasgedvielqsrlkyngfytgkvdgvfgwgtywalrnfqekfglpvdgla
gaktkqmlvkatk