PDB entry 6tch

View 6tch on RCSB PDB site
Description: binary complex of 14-3-3 sigma and a high-affinity non-canonical 9-mer peptide binder
Deposited on 2019-11-06, released 2020-07-01
The last revision was dated 2020-07-08, with a file datestamp of 2020-07-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dly-nva-ppn-kcj-sep-ppn-b3s-bal-ppn-lys
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6TCH
  • Chain 'B':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6tchA (A:)
kvfxsfsafk

    Sequence, based on observed residues (ATOM records):
    >6tchA (A:)
vfxsfsafk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6tchB (B:)
gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt