PDB entry 6tc1

View 6tc1 on RCSB PDB site
Description: 3C-like protease from Southampton virus complexed with FMOPL000283a.
Class: hydrolase
Keywords: Viral protease., HYDROLASE
Deposited on 2019-11-04, released 2020-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Southampton virus (serotype 3) [TaxId:37129]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6tc1a_
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Southampton virus (serotype 3) [TaxId:37129]
    Gene: ORF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6tc1b_
  • Heterogens: MZW, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tc1A (A:)
    apptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrf
    skkirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgm
    lltganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6tc1B (B:)
    pptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrfs
    kkirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgml
    ltganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavqa