PDB entry 6tbn

View 6tbn on RCSB PDB site
Description: Crystal structure of CIAO1-CIAO2B CIA core complex
Class: biosynthetic protein
Keywords: Fe-S cluster, Fe-S, CIA, CIA core complex, BIOSYNTHETIC PROTEIN
Deposited on 2019-11-01, released 2020-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MIP18 family protein galla-2
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: galla-2, CG7949
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VTC4 (4-End)
      • expression tag (1-3)
  • Chain 'B':
    Compound: Probable cytosolic iron-sulfur protein assembly protein Ciao1
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: Ciao1, CG12797
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7K1Y4 (4-337)
      • expression tag (2-3)
    Domains in SCOPe 2.08: d6tbnb1, d6tbnb2
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6tbnB (B:)
    gggrgrlilehtlqghkgriwgvawhpkgnvfascgedkairiwsltgntwstktilsdg
    hkrtireirwspcgqylasasfdattaiwskssgefecnatleghenevksvswsrsggl
    latcsrdksvwiwevagddefecaavlnphtqdvkrvvwhptkdilasasydntikmfae
    epidndwdctatltshtstvwgidfdadgerlvscsddttikiwrayhpgntagvatpdq
    qtvwkcvctvsgqhsraiydvswckltgliatacgddgirifkessdskpdeptfeqita
    eegahdqdvnsvqwnpvvagqliscsddgtikiwkvte
    

    Sequence, based on observed residues (ATOM records): (download)
    >6tbnB (B:)
    grgrlilehtlqghkgriwgvawhpkgnvfascgedkairiwsltgntwstktilsdghk
    rtireirwspcgqylasasfdattaiwskssgefecnatleghenevksvswsrsgglla
    tcsrdksvwiwevagddefecaavlnphtqdvkrvvwhptkdilasasydntikmfaeep
    idndwdctatltshtstvwgidfdadgerlvscsddttikiwrayhpgntagvatpdqqt
    vwkcvctvsgqhsraiydvswckltgliatacgddgirifkessdskpdeptfeqitaee
    gahdqdvnsvqwnpvvagqliscsddgtikiwkvte