PDB entry 6t78

View 6t78 on RCSB PDB site
Description: structure of human sox11 transcription factor in complex with a short dna fragment
Deposited on 2019-10-21, released 2020-04-29
The last revision was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor SOX-11
    Species: Homo sapiens [TaxId:9606]
    Gene: SOX11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription factor SOX-11
    Species: Homo sapiens [TaxId:9606]
    Gene: SOX11
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*tp*gp*tp*tp*tp*ap*tp*tp*tp*tp*gp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*cp*ap*ap*ap*ap*tp*ap*ap*ap*cp*ap*ap*tp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'F':
    Compound: DNA (5'-d(*tp*ap*tp*tp*gp*tp*tp*tp*ap*tp*tp*tp*tp*gp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'G':
    Compound: DNA (5'-d(*ap*ap*cp*ap*ap*ap*ap*tp*ap*ap*ap*cp*ap*ap*tp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6t78A (A:)
snaaldesdpdwcktasghikrpmnafmvwskierrkimeqspdmhnaeiskrlgkrwkm
lkdsekipfireaerlrlkhmadypdykyrprkkpkmdpsakpsasqsp

    Sequence, based on observed residues (ATOM records):
    >6t78A (A:)
sghikrpmnafmvwskierrkimeqspdmhnaeiskrlgkrwkmlkdsekipfireaerl
rlkhmadypdykyrprk

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6t78B (B:)
snaaldesdpdwcktasghikrpmnafmvwskierrkimeqspdmhnaeiskrlgkrwkm
lkdsekipfireaerlrlkhmadypdykyrprkkpkmdpsakpsasqsp

    Sequence, based on observed residues (ATOM records):
    >6t78B (B:)
hikrpmnafmvwskierrkimeqspdmhnaeiskrlgkrwkmlkdsekipfireaerlrl
khmadypdykyrpr

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.