PDB entry 6t6j

View 6t6j on RCSB PDB site
Description: Crystal Structure of the C-terminal domain of the HIV-1 Integrase (subtype A2, mutant N254K, K340Q)
Class: viral protein
Keywords: HIV, integrase, subtype A2, VIRAL PROTEIN
Deposited on 2019-10-18, released 2020-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-17, with a file datestamp of 2021-02-12.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A290WA76 (7-58)
    • expression tag (1-6)
    • engineered mutation (28)
    • engineered mutation (42)
  Domains in SCOPe 2.08: d6t6ja1, d6t6ja2
• Chain 'B':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A290WA76 (7-58)
    • expression tag (1-6)
    • engineered mutation (28)
    • engineered mutation (42)
  Domains in SCOPe 2.08: d6t6jb1, d6t6jb2
• Chain 'C':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A290WA76 (7-58)
    • expression tag (1-6)
    • engineered mutation (28)
    • engineered mutation (42)
  Domains in SCOPe 2.08: d6t6jc1, d6t6jc2
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6t6jA (A:)
  mghhhhhhiqnfrvyyrdsrdpiwkgpaqllwkgegavviqdksdikvvprrkakiird
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6t6jA (A:)
  ghhhhhhiqnfrvyyrdsrdpiwkgpaqllwkgegavviqdksdikvvprrkakiird
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >6t6jB (B:)
  mghhhhhhiqnfrvyyrdsrdpiwkgpaqllwkgegavviqdksdikvvprrkakiird
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6t6jB (B:)
  ghhhhhhiqnfrvyyrdsrdpiwkgpaqllwkgegavviqdksdikvvprrkakiird
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >6t6jC (C:)
  mghhhhhhiqnfrvyyrdsrdpiwkgpaqllwkgegavviqdksdikvvprrkakiird
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6t6jC (C:)
  ghhhhhhiqnfrvyyrdsrdpiwkgpaqllwkgegavviqdksdikvvprrkakiird