PDB entry 6t6i

View 6t6i on RCSB PDB site
Description: Crystal Structure of the C-terminal domain of the HIV-1 Integrase (subtype A2)
Class: viral protein
Keywords: HIV, integrase, M Subtype A2, VIRAL PROTEIN
Deposited on 2019-10-18, released 2020-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pol protein
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A290WA76 (7-58)
    • expression tag (3-6)
  Domains in SCOPe 2.07: d6t6ia1, d6t6ia2
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >6t6iA (A:)
  mghhhhhhiqnfrvyyrdsrdpiwkgpakllwkgegavviqdnsdikvvprrkakiird
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6t6iA (A:)
  hhhhhiqnfrvyyrdsrdpiwkgpakllwkgegavviqdnsdikvvprrkakiird