PDB entry 6t6e

View 6t6e on RCSB PDB site
Description: Crystal Structure of the C-terminal domain of the HIV-1 Integrase (PNL4-3)
Class: viral protein
Keywords: HIV, integrase, PNL4.3, VIRAL PROTEIN
Deposited on 2019-10-18, released 2020-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-10, with a file datestamp of 2021-02-05.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pol protein
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A290WA76 (7-58)
      • expression tag (3-6)
      • conflict (22)
    Domains in SCOPe 2.08: d6t6ea1, d6t6ea2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6t6eA (A:)
    mghhhhhhiqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird
    

    Sequence, based on observed residues (ATOM records): (download)
    >6t6eA (A:)
    hhhhhiqnfrvyyrdsrdpvwkgpakllwkgegavviqdnsdikvvprrkakiird