PDB entry 6t5z

View 6t5z on RCSB PDB site
Description: Crystal structure of an AA10 LPMO from Photorhabdus luminescens
Class: oxidoreductase
Keywords: lytic polysaccharide monooxygenase, copper metalloenzyme, chitin, OXIDOREDUCTASE
Deposited on 2019-10-17, released 2020-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-08-12, with a file datestamp of 2020-08-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chitin-binding type-4 domain-containing protein
  Species: Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
  Gene: plu2352
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7N4I5 (0-173)
  Domains in SCOPe 2.08: d6t5za_
• Chain 'B':
  Compound: Chitin-binding type-4 domain-containing protein
  Species: Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
  Gene: plu2352
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7N4I5 (0-173)
  Domains in SCOPe 2.08: d6t5zb_
• Chain 'C':
  Compound: Chitin-binding type-4 domain-containing protein
  Species: Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) [TaxId:243265]
  Gene: plu2352
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7N4I5 (0-173)
  Domains in SCOPe 2.08: d6t5zc_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6t5zA (A:)
  hgyidspgsraflcsaqgneqnmdcglvkyepqsleakkgfpqagpedghiasagighfg
  aldaqtedrwkkipitageiefqweimiqhktssweyfitklgwdpnkpltreqfnstpf
  cfedyqekmpssrvinkctlpegyqgyhvilgvwtisdtlnafyqvidttispa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6t5zB (B:)
  hgyidspgsraflcsaqgneqnmdcglvkyepqsleakkgfpqagpedghiasagighfg
  aldaqtedrwkkipitageiefqweimiqhktssweyfitklgwdpnkpltreqfnstpf
  cfedyqekmpssrvinkctlpegyqgyhvilgvwtisdtlnafyqvidttispa
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6t5zC (C:)
  hgyidspgsraflcsaqgneqnmdcglvkyepqsleakkgfpqagpedghiasagighfg
  aldaqtedrwkkipitageiefqweimiqhktssweyfitklgwdpnkpltreqfnstpf
  cfedyqekmpssrvinkctlpegyqgyhvilgvwtisdtlnafyqvidttispa