PDB entry 6t5l

View 6t5l on RCSB PDB site
Description: MYO-1 from Myroides odoratimimus. Environmental metallo-beta-lactamases exhibit high enzymatic activity under zinc deprivation
Class: antimicrobial protein
Keywords: beta-lactamase, carbapenemase, environmental, metallo-beta-lactamase, MBL, ANTIMICROBIAL PROTEIN
Deposited on 2019-10-16, released 2020-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-27, with a file datestamp of 2020-05-22.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subclass B1 metallo-beta-lactamase
    Species: Myroides odoratimimus [TaxId:76832]
    Gene: AS202_20055
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6t5la_
  • Chain 'B':
    Compound: Subclass B1 metallo-beta-lactamase
    Species: Myroides odoratimimus [TaxId:76832]
    Gene: AS202_20055
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6t5lb_
  • Heterogens: ZN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6t5lA (A:)
    gqenkkeiinkpltdslivyqtenliinklsnhiyehisflntddfgkvacngmlvlnen
    kvvvfdtptddksslelinfvtntlkseiiglipthfhddciggitefenhniqtyvske
    tiellkdngqefsnptkdfdnsltldignkkvyaeyfgeghtkdnvvgyfpednavfggc
    likeidaskgylgdanikewsttvekvklkypnakivipghgkwggielfdytiklfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6t5lA (A:)
    dslivyqtenliinklsnhiyehisflntddfgkvacngmlvlnenkvvvfdtptddkss
    lelinfvtntlkseiiglipthfhddciggitefenhniqtyvsketiellkdngqefsn
    ptkdfdnsltldignkkvyaeyfgeghtkdnvvgyfpednavfggclikeidaskgylgd
    anikewsttvekvklkypnakivipghgkwggielfdytiklfe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6t5lB (B:)
    gqenkkeiinkpltdslivyqtenliinklsnhiyehisflntddfgkvacngmlvlnen
    kvvvfdtptddksslelinfvtntlkseiiglipthfhddciggitefenhniqtyvske
    tiellkdngqefsnptkdfdnsltldignkkvyaeyfgeghtkdnvvgyfpednavfggc
    likeidaskgylgdanikewsttvekvklkypnakivipghgkwggielfdytiklfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6t5lB (B:)
    ivyqtenliinklsnhiyehisflvacngmlvlnenkvvvfdtptddkssnfvtntleii
    glipthfhddciggitefenhniqtyvsketiellkdngqefsnptkdfdnsltldignk
    kvyaeyfgeghtkdnvvgyfpednavfggclikeidaskgylgdanikewsttvekvklk
    ypnakivipghgkwggielfdytiklfe