PDB entry 6t5g

View 6t5g on RCSB PDB site
Description: Structure of Human Aldose Reductase Mutant L300A with a Citrate Molecule Bound in the Anion Binding Pocket
Class: oxidoreductase
Keywords: Oxidoreductase, L300A Mutant, Citrate Complex
Deposited on 2019-10-16, released 2020-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldo-keto reductase family 1 member B1
    Species: Homo sapiens [TaxId:9606]
    Gene: AKR1B1, ALDR1, ALR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15121 (0-315)
      • conflict (4)
      • engineered mutation (300)
    Domains in SCOPe 2.08: d6t5ga_
  • Heterogens: CIT, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6t5gA (A:)
masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq
eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk
effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp
avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak
hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca
alsctshkdypfheef