PDB entry 6t3y

View 6t3y on RCSB PDB site
Description: Improved High Resolution Structure of MHC Class II complex
Class: immune system
Keywords: MHC II, Immune Synapse, IMMUNE SYSTEM
Deposited on 2019-10-11, released 2020-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-09, with a file datestamp of 2021-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MHC class II alpha chain
    Species: Gallus gallus [TaxId:9031]
    Gene: B-LA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4U5Z6 (2-182)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6t3ya1, d6t3ya2, d6t3ya3
  • Chain 'B':
    Compound: MHC class II beta chain 2
    Species: Gallus gallus [TaxId:9031]
    Gene: BLB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot B5BSA0 (38-223)
      • expression tag (5-21)
  • Heterogens: GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6t3yA (A:)
    arhvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaqg
    alqnmavgkqnlevmisnsnrsqqdfvtpelalfpaeavsleepnvlicyadkfwppvat
    mewrrngavvsegvydsvyygrpdllfrkfsylpfvpqrgdvyscavrhwgaegpvqrmw
    epe
    

  • Chain 'B':
    No sequence available.