PDB entry 6t3c

View 6t3c on RCSB PDB site
Description: Crystal structure of PI3Kgamma in complex with DNA-PK inhibitor AZD7648
Class: transferase
Keywords: kinase fold, type I kinase inhibitor, structure based drug design, TRANSFERASE
Deposited on 2019-10-10, released 2020-01-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 2.62 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
    Species: Homo sapiens [TaxId:9606]
    Gene: PIK3CG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6t3ca1, d6t3ca2, d6t3ca3
  • Heterogens: MBW

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6t3cA (A:)
    mseesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwv
    tskplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdip
    esqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkee
    wplvddctgvtgyheqltihgkdhesvftvslwdcdrkfrvkirgidipvlprntdltvf
    veaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycgkapals
    skasaespsseskgkvqllyyvnlllidhrfllrrgeyvlhmwqisgkgedqgsfnadkl
    tsatnpdkensmsisilldnychpialpkhqptpdpegdrvraempnqlrkqleaiiatd
    plnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqllarrevwdqsal
    dvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepyhdsalarfll
    krglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdftqqvqvieml
    qkvtldikslsaekydvssqvisqlkqklenlqnsqlpesfrvpydpglkagalaiekck
    vmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiwetesldl
    cllpygcistgdkigmieivkdattiakiqqstvgntgafkdevlnhwlkekspteekfq
    aaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghilgnyksflginker
    vpfvltpdflfvmgtsgkktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmpql
    tskedieyirdaltvgkneedakkyfldqievcrdkgwtvqfnwflhlvlgikqgekhsa
    hhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6t3cA (A:)
    eesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvts
    kplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmdfvlrvcgrdey
    lvgetpiknfqwvrhclkngeeihvvldtppdpaldevrkecdrkfrvkirgidipvldl
    tvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsikikdlpkgallnlqiycvqll
    yyvnlllidhrfllrrgeyvlhmwqisfnadkltsatnpdkensmsisilldnempnqlr
    kqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqeivaktyqlla
    rrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllqlvqavkfepy
    hdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylrgcgtamlhdf
    tqqvqviemlqkvtldikslkydvssqvisqlkqklenlqnsqlpesfrvpydpglkaga
    laiekckvmaskkkplwlefkcadptalsnetigiifkhgddlrqdmlilqilrimesiw
    etesldlcllpygcistgdkigmieivkdattiakiqqstvgnafkdevlnhwlkekspt
    eekfqaaverfvyscagycvatfvlgigdrhndnimitetgnlfhidfghikervpfvlt
    pdflfvmgtsktsphfqkfqdicvkaylalrhhtnlliilfsmmlmtgmtskedieyird
    altvgkneedakkyfldqievcrdkgwtvqfnwflhlvl