PDB entry 6t35

View 6t35 on RCSB PDB site
Description: Crystal structure of AmpC from E.coli with Enmetazobactam (AAI-101)
Class: hydrolase
Keywords: beta lactamase, antibiotic resistance, antimicrobial protein, mechanism based inhibitor, hydrolase
Deposited on 2019-10-10, released 2020-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-11-18, with a file datestamp of 2020-11-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: ampC, ampA, b4150, JW4111
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6t35a_
  • Heterogens: M9W, SO4, PEG, ZN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6t35A (A:)
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq