PDB entry 6t2l

View 6t2l on RCSB PDB site
Description: Streptavidin variants harbouring an artificial organocatalyst based cofactor
Class: biotin-binding protein
Keywords: artificial cofactor, streptavidin, catalyst, Biotin-binding protein
Deposited on 2019-10-09, released 2020-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-05-12, with a file datestamp of 2021-05-07.
Experiment type: XRAY
Resolution: 1 Å
R-factor: N/A
AEROSPACI score: 0.9 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629
      • engineered mutation (46)
      • engineered mutation (48)
      • engineered mutation (111)
      • engineered mutation (113)
      • engineered mutation (118)
      • engineered mutation (120)
    Domains in SCOPe 2.08: d6t2la_
  • Heterogens: HL9, EDO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6t2lA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesaagkaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltagateangw
    astlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6t2lA (A:)
    agitgtwynqlgstfivtagadgaltgtyesaagkaesryvltgrydsapatdgsgtalg
    wtvawknnyrnahsattwsgqyvggaearintqwlltagateangwastlvghdtftkvk
    p