PDB entry 6t2e

View 6t2e on RCSB PDB site
Description: multicomponent peptide stapling as a diversity-driven tool for the development of inhibitors of protein-protein interactions
Deposited on 2019-10-08, released 2020-01-29
The last revision was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00987 (1-85)
      • engineered mutation (9)
  • Chain 'B':
    Compound: Stapled peptide GAR300-Gm
    Species: synthetic construct, synthetic [TaxId:32630]
    Database cross-references and differences (RAF-indexed):
    • PDB 6T2E (0-13)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6t2eA (A:)
metlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllg
dlfgvpsfsvkehrkiytmiyrnlvv

    Sequence, based on observed residues (ATOM records):
    >6t2eA (A:)
etlvrpkpellkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhivycsndllgd
lfgvpsfsvkehrkiytmiyrnlvv

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6t2eB (B:)
ltfeqywaqlesaa