PDB entry 6t1l

View 6t1l on RCSB PDB site
Description: crystal structure of mllt1 (enl) yeats domain in complexed with piperazine-urea derivative 3
Deposited on 2019-10-04, released 2019-11-06
The last revision was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein ENL
    Species: Homo sapiens [TaxId:9606]
    Gene: MLLT1, ENL, LTG19, YEATS1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: M7N, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6t1lA (A:)
mdnqctvqvrlelghraqlrkkpttegfthdwmvfvrgpeqcdiqhfvekvvfwlhdsfp
kprrvckeppykveesgyagfimpievhfknkeeprkvcftydlflnlegnppvnhlrce
kltfnnpttefrykllraggvmvmpegahhhhhh

    Sequence, based on observed residues (ATOM records):
    >6t1lA (A:)
nqctvqvrlelghraqlrkkpttegfthdwmvfvrgpeqcdiqhfvekvvfwlhdsfpkp
rrvckeppykveesgyagfimpievhfknkeeprkvcftydlflnlegnppvnhlrcekl
tfnnpttefrykllraggvmvm