PDB entry 6syg

View 6syg on RCSB PDB site
Description: crystal structure of the cyclic nucleotide-binding homology domain of the human kcnh2 channel
Deposited on 2019-09-27, released 2020-03-04
The last revision was dated 2020-04-29, with a file datestamp of 2020-04-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium voltage-gated channel subfamily H member 2
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNH2, ERG, ERG1, HERG
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12809 (4-134)
      • expression tag (0-3)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6sygA (A:)
gamgrsllqhckpfrgatkgclralamkfktthappgdtlvhagdlltalyfisrgsiei
lrgdvvvailgkndifgeplnlyarpgksngdvraltycdlhkihrddllevldmypefs
dhfwssleitfnlrd