PDB entry 6sy2

View 6sy2 on RCSB PDB site
Description: structure of the brk domain of the swi/snf chromatin remodelling complex subunit brg1 reveals a potential role in protein-protein interactions
Deposited on 2019-09-27, released 2020-01-22
The last revision was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription activator BRG1
    Species: Homo sapiens [TaxId:9606]
    Gene: SMARCA4
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6sy2A (A:)
sqmsdlpvkvihvesgkiltgtdapkagqleawlemnpgyevaprsdse