PDB entry 6sxw

View 6sxw on RCSB PDB site
Description: crystal structure of the first rrm domain of human zinc finger protein 638 (znf638)
Deposited on 2019-09-26, released 2019-10-16
The last revision was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger protein 638
    Species: Homo sapiens [TaxId:9606]
    Gene: ZNF638, NP220, ZFML
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6sxwA (A:)
    svllitelpedgcteedvrklfqpfgkvndvlivpyrkeaylemefkeaitaimkyiett
    pltikgksvkicvp