PDB entry 6sxt

View 6sxt on RCSB PDB site
Description: GH54 a-l-arabinofuranosidase soaked with aziridine inhibitor
Class: hydrolase
Keywords: Covalent complex, Arabinofuranosidase, GH54, Aspergillus, HYDROLASE
Deposited on 2019-09-26, released 2020-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-L-arabinofuranosidase B
    Species: Aspergillus kawachii (strain NBRC 4308) [TaxId:1033177]
    Gene: abfB, AKAW_08685
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NK89 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6sxta1, d6sxta2, d6sxta3
  • Heterogens: LXE, ALA, NAG, SO4, ACT, PEG, PGE, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sxtA (A:)
    smgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasa
    qdtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkay
    gvfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghme
    aiylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwa
    irganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyp
    sddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvv
    dddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfheda
    tfcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeieta
    fas
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sxtA (A:)
    smgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasa
    qdtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkay
    gvfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghme
    aiylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwa
    irganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyp
    sddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvv
    dddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfheda
    tfcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeieta
    fa