PDB entry 6sxr

View 6sxr on RCSB PDB site
Description: E221Q mutant of GH54 a-l-arabinofuranosidase soaked with 4-nitrophenyl a-l-arabinofuranoside
Class: hydrolase
Keywords: Michaelis Complex, Arabinofuranosidase, GH54, Aspergillus, HYDROLASE
Deposited on 2019-09-26, released 2020-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-L-arabinofuranosidase B
    Species: Aspergillus kawachii IFO 4308 [TaxId:1033177]
    Gene: abfB, AKAW_08685
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NK89 (1-End)
      • initiating methionine (0)
      • engineered mutation (203)
    Domains in SCOPe 2.08: d6sxra1, d6sxra2
  • Heterogens: KHP, NAG, SO4, ACT, EDO, PEG, PGE, 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sxrA (A:)
    mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
    dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
    vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
    iylgnsttwgygagdgpwimvdmqnnlfsgadegynsgdpsisyrfvtaavkggadkwai
    rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
    ddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvvd
    ddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfhedat
    fcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeietaf
    as
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sxrA (A:)
    mgpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaq
    dtfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkayg
    vfmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmea
    iylgnsttwgygagdgpwimvdmqnnlfsgadegynsgdpsisyrfvtaavkggadkwai
    rganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgyps
    ddtensvqenivaakyvvgslvsgpsftsgevvslrvttpgyttryiahtdttvntqvvd
    ddssttlkeeaswtvvtglansqcfsfesvdtpgsyirhynfelllnandgtkqfhedat
    fcpqaalngegtslrswsyptryfrhyenvlyaasnggvqtfdsktsfnndvsfeietaf
    a