PDB entry 6swx

View 6swx on RCSB PDB site
Description: Leishmania major methionyl-tRNA synthetase in complex with an allosteric inhibitor
Class: translation
Keywords: leishmania, parasite, aminoacyl-tRNA synthetase, tRNA ligase, aars, metrs, methionine, translation, ATP-binding, nucleotide-binding, ligase, drug discovery, dundee drug discovery unit
Deposited on 2019-09-24, released 2020-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-05, with a file datestamp of 2020-07-31.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative methionyl-tRNA synthetase
    Species: Leishmania major [TaxId:5664]
    Gene: LMJF_21_0810
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q4QCD2 (22-End)
      • expression tag (21)
    Domains in SCOPe 2.07: d6swxa1, d6swxa2, d6swxa3
  • Heterogens: LWN, MET, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6swxA (A:)
    mahhhhhhmgtleaqtqgpgsmkkqkvffattpiyyvnasphighvystlivdvlgryhr
    vkgeevfvmtgtdehgqkvaeaaakqgvspmdfttsvssefkqcfqemnydmnyfirttn
    ptheklvqdiwkklaakgdiylgkyegwysvsdesfltaqnvadgvdrdgkpckvslesg
    hvvtwveeenymfrlsafrerllkyfhdhpncivpefrrreviktvekglfdlsisrkre
    svmnwsipvpgderhciyvwldalfnyytgaltrvatdgtetldedhhalnrwpadvhvv
    gkdilkfhaiywpaflmsaelplperlvshgwwtkdhkkiskslgnafdpvekakefgid
    alkyflmresnfqddgdysdknmvarlngeladtlgnlvsrcvapkinvngmwpepaeys
    esdktliaslnnlagtvdhyyclpdiqhaliaifdvlrslnayvtenapwklvkmdtarl
    gtvlyvtmeglrictmflqpvmpqkakeimdalgvpeaarvgmenylfgivkpgtkiagl
    aegqvvfqkvtlpteegersskgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6swxA (A:)
    mkkqkvffattpiyyvnasphighvystlivdvlgryhrvkgeevfvmtgtdehgqkvae
    aaakqgvspmdfttsvssefkqcfqemnydmnyfirttnptheklvqdiwkklaakgdiy
    lgkyegwysvsdesfltaqnvadgvdrdgkpckvslesghvvtwveeenymfrlsafrer
    llkyfhdhpncivpefrrreviktvekglfdlsisrkresvmnwsipvpgderhciyvwl
    dalfnyytgaltrvatdgtetldedhhalnrwpadvhvvgkdilkfhaiywpaflmsael
    plperlvshgwwtkdhkkisksnafdpvekakefgidalkyflmresnfqddgdysdknm
    varlngeladtlgnlvsrcvapkinvngmwpepaeysesdktliaslnnlagtvdhyycl
    pdiqhaliaifdvlrslnayvtenapwklvkmdtarlgtvlyvtmeglrictmflqpvmp
    qkakeimdalgvpeaarvgmenylfgivkpgtkiaglaegqvvfqkvtlp