PDB entry 6swh

View 6swh on RCSB PDB site
Description: Crystal structure of the ternary complex between the type 1 pilus proteins FimC, FimI and FimA from E. coli
Class: structural protein
Keywords: structural protein, structural protein complex, pilus assembly inhibition
Deposited on 2019-09-20, released 2020-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-07, with a file datestamp of 2020-10-02.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chaperone protein fimc
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimC, b4316, JW4279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6swha1, d6swha2
  • Chain 'B':
    Compound: Fimbrin-like protein FimI
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimI, b4315, JW5779
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6swhb_
  • Chain 'C':
    Compound: Type-1 fimbrial protein, A chain
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimA, pilA, b4314, JW4277
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: chaperone protein fimc
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimC, b4316, JW4279
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6swhd1, d6swhd2
  • Chain 'E':
    Compound: Fimbrin-like protein FimI
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimI, b4315, JW5779
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6swhe_
  • Chain 'F':
    Compound: Type-1 fimbrial protein, A chain
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: fimA, pilA, b4314, JW4277
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6swhA (A:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6swhB (B:)
    gnkwnttlpggnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvih
    lrecstvvservgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppan
    wkrlysgstslhfiakyratgrrvtggianaqawfsltyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6swhB (B:)
    gnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecstvvse
    rvgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwkrgstslhf
    iakyratgrrvtggianaqawfsltyq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6swhD (D:)
    gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
    kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
    alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsd
    agsnityrtindygaltpkmtgvme
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6swhE (E:)
    gnkwnttlpggnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvih
    lrecstvvservgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppan
    wkrlysgstslhfiakyratgrrvtggianaqawfsltyq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6swhE (E:)
    ttlpggnmqfqgviiaetcrieagdkqmtvnmgqissnrfhavgedsapvpfvihlrecs
    tvvservgvafhgvadgknpdvlsvgegpgiatnigvalfddegnlvpinrppanwksts
    lhfiakyratgrrvtggianaqawfsltyq
    

  • Chain 'F':
    No sequence available.