PDB entry 6svv

View 6svv on RCSB PDB site
Description: Reference structure of bovine trypsin (odd frames of crystal x30)
Class: hydrolase
Keywords: bovine trypsin, hydrolase, Terahertz irradiation, odd frames, x30
Deposited on 2019-09-19, released 2020-01-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cationic trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6svva_
  • Heterogens: CA, BEN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6svvA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn