PDB entry 6svc

View 6svc on RCSB PDB site
Description: Protein allostery of the WW domain at atomic resolution: apo structure
Class: peptide binding protein
Keywords: structure from cyana 3.98.12, peptide binding protein
Deposited on 2019-09-18, released 2020-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-10-21, with a file datestamp of 2020-10-16.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (1-34)
      • expression tag (0)
      • engineered mutation (13)
      • engineered mutation (29)
    Domains in SCOPe 2.07: d6svca1, d6svca2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6svcA (A:)
    sklppgwekrmsrnsgrvyyfnhitnasqferpsg