PDB entry 6sv3

View 6sv3 on RCSB PDB site
Description: Structure of coproheme-LmCpfC
Class: metal binding protein
Keywords: Ferrochelatase, Prokaryotic heme biosynthesis, ferredoxin-like fold, METAL BINDING PROTEIN
Deposited on 2019-09-17, released 2019-12-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-15, with a file datestamp of 2020-07-10.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferrochelatase
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: hemH, A4G43_07995, AF115_13645, AP101_13400, AP103_13395, AP112_12715, AP127_13135, AP130_13225, APD66_13050, ARS86_05675, B1N21_11380, B4Y57_13635, B5G78_12175, B5H07_07285, BRS71_03785, D3X95_05200, D3Y03_05130, D8K64_06195, EAJ22_07595, EAX63_13360, EFX44_12300, SG10_07760
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A3T2BSC5 (Start-308)
      • expression tag (309-310)
    Domains in SCOPe 2.08: d6sv3a1, d6sv3a2
  • Heterogens: FEC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sv3A (A:)
    mtkkvgllvmaygtpykdedieryytdirhghkpseemiadlrgryhaigglsplakite
    aqayglekalndsqdevefkayiglkhiepfiedaveamhkdgieeaisivlaphyssfs
    veaynkrakeaadklggprinaindwykqpkfiqmwadrinetakqipadelldtvlivs
    ahslpekikqhndpypnqlqetadfifekvvvphyalgwqsegktgepwlgpdvqdltre
    lygrekykhfiytpvgfvaehlevlydndyeckvvtdevgaayhrppmpnsdpeflevlr
    tvvwekysnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sv3A (A:)
    kkvgllvmaygtpykdedieryytdirhghkpseemiadlrgryhaigglsplakiteaq
    ayglekalndsqdevefkayiglkhiepfiedaveamhkdgieeaisivlaphyssfsve
    aynkrakeaadklggprinaindwykqpkfiqmwadrinetakqipadelldtvlivsah
    slpekikqhndpypnqlqetadfifekvvvphyalgwqsegktgepwlgpdvqdltrely
    grekykhfiytpvgfvaehlevlydndyeckvvtdevgaayhrppmpnsdpeflevlrtv
    vwekysnle