PDB entry 6su8

View 6su8 on RCSB PDB site
Description: Highly thermostable endoglucanase Cel7B
Class: hydrolase
Keywords: Thermostable, Cel7B, Rasamsonia emersonii, cellulase, glycan rich, biofuels, biomass degradation, glycoside hydrolase family 7, HYDROLASE
Deposited on 2019-09-13, released 2019-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucanase
    Species: Talaromyces emersonii [TaxId:68825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8P1L2 (0-End)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d6su8a_
  • Chain 'B':
    Compound: glucanase
    Species: Talaromyces emersonii [TaxId:68825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8P1L2 (0-End)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d6su8b_
  • Chain 'C':
    Compound: glucanase
    Species: Talaromyces emersonii [TaxId:68825]
    Database cross-references and differences (RAF-indexed):
    • Uniprot W8P1L2 (0-End)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d6su8c_
  • Heterogens: BMA, NAG, PCA, MLI, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6su8A (A:)
    eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
    cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
    ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
    qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
    cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
    psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
    pcnstegnpatieaqhpdtavtfsnirwgdigstfqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6su8A (A:)
    eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
    cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
    ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
    qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
    cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
    psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
    pcnstegnpatieaqhpdtavtfsnirwgdigstfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6su8B (B:)
    eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
    cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
    ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
    qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
    cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
    psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
    pcnstegnpatieaqhpdtavtfsnirwgdigstfqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6su8B (B:)
    eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
    cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
    ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
    qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
    cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
    psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
    pcnstegnpatieaqhpdtavtfsnirwgdigstfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6su8C (C:)
    eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
    cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
    ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
    qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
    cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
    psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
    pcnstegnpatieaqhpdtavtfsnirwgdigstfqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6su8C (C:)
    eqigtipevhpklptwkctteggcvqqntsvvleylshpihevgnsdvscvvsgglnqsl
    cpneeecskncvveganytssgvhtdgdaltlnqyvtngdqvvtasprvyllasddedgn
    ysmlqllgqelsfdvdvsklvcgmngalylsemdasggrnslnpagaqygsgycdaqcgv
    qpfingtvntgslgaccnemdiweanalataltphpcsvtsiyacsgaecgsngvcdkpg
    cgynpyalgdhnyygpgktvdtsrpftvvtqfltndntttgtlteirrlyvqdgnvigps
    psdsvssitdsfcstvdsyfeplgglkemgealgrgmvlvfsiwndpgqfmnwldsgnag
    pcnstegnpatieaqhpdtavtfsnirwgdigstfq