PDB entry 6stk

View 6stk on RCSB PDB site
Description: Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
Class: immune system
Keywords: cc-chemokine, immune system
Deposited on 2019-09-10, released 2020-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501
      • engineered mutation (65)
    Domains in SCOPe 2.08: d6stka_
  • Chain 'B':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501
      • engineered mutation (65)
    Domains in SCOPe 2.08: d6stkb_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6stkA (A:)
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslsms

    Sequence, based on observed residues (ATOM records): (download) 
    >6stkA (A:)
yssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyi
nslsm

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >6stkB (B:)
spyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvre
yinslsms

    Sequence, based on observed residues (ATOM records): (download) 
    >6stkB (B:)
yssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyi
nsls