PDB entry 6stc

View 6stc on RCSB PDB site
Description: crystal structure of the tick chemokine-binding protein evasin-4 (sg 2)
Deposited on 2019-09-10, released 2020-09-02
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Evasin-4
    Species: Rhipicephalus sanguineus [TaxId:34632]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, PEG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6stcA (A:)
evpqmtsssapdleeeddytayapltcyftnstlgllappncsvlcnstttwfnetspnn
asclltvdfltqdailqenqpyncsvghcdngtcagpprhaqcw

    Sequence, based on observed residues (ATOM records):
    >6stcA (A:)
eddytayapltcyftnstlgllappncsvlcnstttwfnetspnnasclltvdfltqdai
lqenqpyncsvghcdngtcagpprhaqcw