PDB entry 6ssq

View 6ssq on RCSB PDB site
Description: Crystal structure of RARbeta LBD in complex with LG 100754
Class: transcription
Keywords: Nuclear receptor, Ligand binding, TRANSCRIPTION
Deposited on 2019-09-09, released 2019-11-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RARB, HAP, NR1B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10826
      • conflict (259)
    Domains in SCOPe 2.08: d6ssqa_
  • Chain 'B':
    Compound: Retinoic acid receptor beta
    Species: Homo sapiens [TaxId:9606]
    Gene: RARB, HAP, NR1B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10826 (21-End)
      • expression tag (12-20)
      • conflict (259)
    Domains in SCOPe 2.08: d6ssqb1, d6ssqb2
  • Chain 'F':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, BHLHE74, SRC1
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Nuclear receptor coactivator 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NCOA1, BHLHE74, SRC1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 754, FLC, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ssqA (A:)
    mgsshhhhhhssglvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssa
    dhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililric
    trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaicl
    icgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaer
    vitlkmeipgsmppliqemmenseghe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ssqA (A:)
    syemtaelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkci
    ikivefakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtq
    mhnagfgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepll
    ealkiyirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ssqB (B:)
    mgsshhhhhhssglvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssa
    dhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililric
    trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaicl
    icgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaer
    vitlkmeipgsmppliqemmenseghe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ssqB (B:)
    glvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwd
    kfselatkciikivefakrlpgftgltiadqitllkaacldililrictrytpeqdtmtf
    sdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaiclicgdrqdleept
    kvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaervitlkmeipgsm
    ppliqemme
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.