PDB entry 6ssc

View 6ssc on RCSB PDB site
Description: N-acetylmuramoyl-L-alanine amidase LysC from Clostridium intestinale URNW
Class: hydrolase
Keywords: amidase, zinc binding, cell wall degradation, endolysine, hydrolase
Deposited on 2019-09-06, released 2020-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetylmuramoyl-l-alanine amidase
    Species: Clostridium intestinale [TaxId:36845]
    Gene: CINTURNW_1763
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6ssca_
  • Heterogens: ZN, PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sscA (A:)
    mgsshhhhhhssglvprgshmknllrrirrklrnkfsrsdviktpkivevnytwatplsy
    nfnpnmivyhhtvdnnmtpqkideihkqrgwsgigyhfyirkdgtiyrgrpenavgshap
    gvnarafgiasegnfneeyvtpqqmtslialsrylmnkynitdlkrhkdvrqtecpgnnf
    pfeeikaklnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sscA (A:)
    tpkivevnytwatplsynfnpnmivyhhtvdnnmtpqkideihkqrgwsgigyhfyirkd
    gtiyrgrpenavgshapgvnarafgiasegnfneeyvtpqqmtslialsrylmnkynitd
    lkrhkdvrqtecpgnnfpfeeikaklnvk