PDB entry 6so9

View 6so9 on RCSB PDB site
Description: mouse rbm20 rrm domain in complex with aucuua rna
Deposited on 2019-08-29, released 2019-11-06
The last revision was dated 2020-05-13, with a file datestamp of 2020-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA-binding protein 20
    Species: Mus musculus [TaxId:10090]
    Gene: Rbm20
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3UQS8 (3-111)
      • expression tag (0-2)
  • Chain 'B':
    Compound: aucuua
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ADN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6so9A (A:)
gamaqrkgagrvvhicnlpegsctendvinlglpfgkvtnyilmkstnqaflemayteaa
qamvqyyqekpaiingekllirmstrykelqlkkpgknvaaiiqdihsqrer

  • Chain 'B':
    No sequence available.