PDB entry 6slz

View 6slz on RCSB PDB site
Description: Crystal structure of human ROR gamma LBD in complex with a (quinolinoxymethyl)benzamide inverse agonist
Class: transcription
Keywords: RORg, inverse agonist, nuclear hormone receptor, transcription
Deposited on 2019-08-21, released 2020-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6slza_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6slzb_
  • Heterogens: LK8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6slzA (A:)
    gshmaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6slzA (A:)
    eiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteai
    qyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelf
    ralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlel
    afhhhlckthrqsilaklppgklrslcsqhverlqifq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6slzB (B:)
    gshmaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerc
    ahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffeg
    kyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkve
    qlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpp
    lykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6slzB (B:)
    iehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlteaiq
    yvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggmelfr
    algcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynlela
    fhhhlckthrqsilaklppkgklrslcsqhverlqifq