PDB entry 6slv

View 6slv on RCSB PDB site
Description: fragment az-013 binding at the p53pt387/14-3-3 sigma interface
Deposited on 2019-08-20, released 2020-06-17
The last revision was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein sigma
    Species: Homo sapiens [TaxId:9606]
    Gene: SFN, HME1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31947 (5-235)
      • expression tag (0-4)
  • Chain 'P':
    Compound: Cellular tumor antigen p53
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LJW, MG, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6slvA (A:)
    gamgsmerasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggq
    raawrvlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdae
    srvfylkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglaln
    fsvfhyeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >6slvP (P:)
    klmfktegpdsd