PDB entry 6sld

View 6sld on RCSB PDB site
Description: Structure of the Phosphatidylcholine Binding Mutant of Yeast Sec14 Homolog Sfh1 (S175I,T177I) in Complex with Phosphatidylinositol
Class: lipid transport
Keywords: Sec14, Sfh1, Phosphatidylcholine, Phosphatidylinositol, LIPID TRANSPORT
Deposited on 2019-08-19, released 2020-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRAL-TRIO domain-containing protein YKL091C
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: YKL091C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33324 (0-306)
      • engineered mutation (171)
      • engineered mutation (173)
    Domains in SCOPe 2.07: d6slda1, d6slda2
  • Heterogens: B7N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6sldA (A:)
sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf
dinasvemfveterwreeygantiiedyennkeaedkeriklakmypqyyhhvdkdgrpl
yfeelgginlkkmykittekqmlrnlvkeyelfatyrvpacsrragylieticivldlkg
islsnayhvlsyikdvadisqnyypermgkfyiihspfgfstmfkmvkpfldpvtvskif
ilgssykkellkqipienlpvkyggtsvlhnpndkfyysdigpwrdpryigpegeipnif
gkftvts