PDB entry 6sl5

View 6sl5 on RCSB PDB site
Description: Dunaliella Photosystem I Supercomplex
Class: photosynthesis
Keywords: membrane complex, photosystem I, dunaliella, light harvesting, excitation transfer, PHOTOSYNTHESIS
Deposited on 2019-08-18, released 2020-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-06-24, with a file datestamp of 2020-06-19.
Experiment type: EM
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain '1':
  Compound: Chlorophyll a-b binding protein, chloroplastic
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • Uniprot C1K003 (0-196)
    • conflict (172)
• Chain '2':
  Compound: Lhca2
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-207)
  Domains in SCOPe 2.07: d6sl52_
• Chain '3':
  Compound: Chlorophyll a-b binding protein, chloroplastic
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-227)
  Domains in SCOPe 2.07: d6sl53_
• Chain '4':
  Compound: Lhca4
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-210)
  Domains in SCOPe 2.07: d6sl54_
• Chain '5':
  Compound: Lhca5
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-201)
• Chain '6':
  Compound: Lhca6
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-177)
• Chain 'A':
  Compound: photosystem I p700 chlorophyll a apoprotein a1
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0FXV2 (0-739)
• Chain 'B':
  Compound: photosystem I p700 chlorophyll a apoprotein a2
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0FXZ0 (0-732)
• Chain 'C':
  Compound: photosystem I iron-sulfur center
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0FXW7 (0-79)
• Chain 'D':
  Compound: PsaD
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-143)
  Domains in SCOPe 2.07: d6sl5d_
• Chain 'E':
  Compound: PsaE
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-63)
• Chain 'F':
  Compound: PsaF
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-161)
• Chain 'G':
  Compound: PsaG
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-100)
• Chain 'H':
  Compound: PsaH
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-91)
• Chain 'I':
  Compound: PsaI
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-38)
• Chain 'J':
  Compound: Photosystem I reaction center subunit IX
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • Uniprot D0FXW0 (0-40)
• Chain 'K':
  Compound: PsaK
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-83)
• Chain 'L':
  Compound: PsaL
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-154)
• Chain 'O':
  Compound: PsaO
  Species: Dunaliella salina [TaxId:3046]
  Database cross-references and differences (RAF-indexed):
  • PDB 6SL5 (0-85)
• Heterogens: CL0, CLA, PQN, SF4, BCR, LHG, OCD, LMU, DGD, 3PH, CA, LMG, 4RF, PTY, LUT, XAT, CHL, SQD, LMK, P3H

PDB Chain Sequences:

• Chain '1':
  No sequence available.
  
  
• Chain '2':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6sl52 (2:)
  drplwspgseppawldgslagdygfdplhlseepemrkwmvqaelvhcrwamlgvagilf
  tsigakaggnfpdwydagkelqknsdiplgsliftelllfgwvetkrlydlrnpgsqgdg
  sflgitdglkgkengypgglfdpmgmskneasfkeakqkevkngrlamlafvgfiaqhha
  thkspidnlldhvadpfhvtfatngvsi
  

  
  
• Chain '3':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6sl53 (3:)
  skdflyvgsdaaalkyldgtlpgdygfdplglldptvsngqgaggfvnprwlqyseviha
  rwamlgaagciapeilgkagvipaetavdwfrtgvippagvykdfwadpftlffievvai
  qfaelkrlqdyknpgsqsrqyflgleglfkgsdnpaypggpffnfanfgkteaemkklkl
  neikngrlamlamfgygaqavitgdgpfdnllahladptganlitnlg
  

  
  
• Chain '4':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6sl54 (4:)
  drplwypgatppahldgsmlgdygfdplrlgtnpdrmkwfreaeltngrwamaavvgilf
  tdvftsiglvglpkwweagaqtypidnqtlrtlaiiefllfgwvetkrlydlrnpgsqgd
  gsflgitdglkgtengypggifdplgysktspekldelqngrlamlaflgfastaavngq
  gpieslqthladpfhvtfatngvsiphftef
  

  
  
• Chain '5':
  No sequence available.
  
  
• Chain '6':
  No sequence available.
  
  
• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >6sl5D (D:)
  pwkqpeldpdtpspifggstggllrkaqveefyvitwespkeqifemptggaaimrkgpn
  llkfarkeqcmalttqlrskfrqtpcfyrvyadgkvqylhpkdgvypekvnagrvgvnqn
  mrsigknvdpikvvkftgsapfei
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >6sl5D (D:)
  pwkqpeldpdtpspifggstggllrkaqveefyvitwespkeqifemptggaaimrkgpn
  llkfarkeqcmalttqlrskfrqtpcfyrvyadgkvqylhpkdgvypekvnagrvgvnqn
  mrsigknvdpikvkftgsapfei
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.