PDB entry 6sjw

View 6sjw on RCSB PDB site
Description: structure of the self-processing module of iron-regulated frpc of n. meningitidis with calcium ions
Deposited on 2019-08-14, released 2020-02-26
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Iron-regulated protein FrpC
    Species: Neisseria meningitidis NM95 [TaxId:1145153]
    Gene: frpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55127 (0-176)
      • conflict (38)
      • conflict (100)
      • conflict (156)
      • expression tag (177-178)
  • Heterogens: CA

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6sjwA (A:)
    plaldldgdgietvatkgfsgslfdhnrdgirtatgwvsaddgllvrdlngngiidngae
    lfgdntkladgsfakhgyaalaeldsngdniinaadaafqslrvwqdlnqdgisqanelr
    tleelgiqsldlaykdvnknlgngntlaqqgsytktngttakmgdlllaadnlhsrfle