PDB entry 6sif

View 6sif on RCSB PDB site
Description: epidermicin antimicrobial protein from staphylococcus epidermidis
Deposited on 2019-08-09, released 2020-08-26
The last revision was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Epidermicin locus structural protein
    Species: Staphylococcus epidermidis [TaxId:1282]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6sifA (A:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6sifB (B:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6sifC (C:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6sifD (D:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

    Sequence, based on observed residues (ATOM records):
    >6sifD (D:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklw

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6sifE (E:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

    Sequence, based on observed residues (ATOM records):
    >6sifE (E:)
aafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records:
    >6sifF (F:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6sifG (G:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

    Sequence, based on observed residues (ATOM records):
    >6sifG (G:)
aafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikk

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6sifH (H:)
maafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa

    Sequence, based on observed residues (ATOM records):
    >6sifH (H:)
aafmkliqflatkgqkyvslawkhkgtilkwinagqsfewiykqikklwa