PDB entry 6shr

View 6shr on RCSB PDB site
Description: x-ray crystal structure of cell-free protein synthesis (cfps) produced sdf1-a
Class: cytokine
Keywords: cytokine, cell-free protein synthesis (cfps)
Deposited on 2019-08-08, released 2020-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-26, with a file datestamp of 2020-08-21.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stromal cell-derived factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CXCL12, SDF1, SDF1A, SDF1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6shra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6shrA (A:)
lsyrcpcrffeshvaranvkhlkilntpncalqivarlknnnrqvcidpklkwiqeylek
alnk