PDB entry 6sfj

View 6sfj on RCSB PDB site
Description: Crystal structure of p38 alpha in complex with compound 77 (MCP41)
Class: transferase
Keywords: p38a, MAPK, MAPK14, kinase inhibitor, Structural Genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2019-08-01, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2, SAPK2A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539
      • conflict (48)
      • conflict (263)
    Domains in SCOPe 2.07: d6sfja_
  • Heterogens: LBB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6sfjA (A:)
    gmsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpf
    qsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkc
    qkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddem
    tgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlv
    gtpgaellkkissesarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkrita
    aqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldqeeme
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sfjA (A:)
    erptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktghrvavkklsrpfqsii
    hakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqklt
    ddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarvatrwyrape
    imlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkiss
    esarnyiqslaqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyh
    dpddepvadpydqsfesrdllidewksltydevisfvpppl