PDB entry 6sf1

View 6sf1 on RCSB PDB site
Description: Bone morphogenetic protein 10 (BMP10) complexed with extracellular domain of activin receptor-like kinase 1 (ALK1).
Class: cytokine
Keywords: BMP10, ALK1, complex, signalling, TGFbeta, BMP, CYTOKINE
Deposited on 2019-07-30, released 2020-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase receptor R3
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVRL1, ACVRLK1, ALK1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bone morphogenetic protein 10
    Species: Homo sapiens [TaxId:9606]
    Gene: BMP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6sf1b_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6sf1B (B:)
    nakgnyckrtplyidfkeigwdswiiappgyeayecrgvcnyplaehltptkhaiiqalv
    hlknsqkaskaccvptklepisilyldkgvvtykfkyegmavsecgcr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6sf1B (B:)
    nyckrtplyidfkeigwdswiiappgyeayecrgvcnyplaehltptkhaiiqalvhlkn
    sqkaskaccvptklepisilyldkgvvtykfkyegmavsecgcr