PDB entry 6sdy

View 6sdy on RCSB PDB site
Description: Solution structure of Staufen1 dsRBD4 - hARF1 SBS dsRNA complex.
Class: RNA binding protein
Keywords: dsRBD-dsRNA binding protein, Staufen1 protein, Staufen mediated mRNA decay, NMR structure of RNA-protein complex, RNA binding protein, RNA binding domain.
Deposited on 2019-07-29, released 2020-01-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-binding protein Staufen homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: STAU1, STAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95793 (4-73)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d6sdya1, d6sdya2
  • Chain 'B':
    Compound: hARF1 SBS dsRNA
    Species: Homo sapiens [TaxId:9606]

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6sdyA (A:)
    gshmnpisrlaqiqqakkekepeytllterglprrrefvmqvkvgnhtaegtgtnkkvak
    rnaaenmleilgfk
    

  • Chain 'B':
    No sequence available.